AI safety, systems architecture, adversarial thinking. Projects, writing, audio, and visual work.https://adrianwedd.com/https://adrianwedd.com/blog/make-ai-data-centres-pay-their-own-way/https://adrianwedd.com/blog/make-ai-data-centres-pay-their-own-way/AI data centres are infrastructure choices, not inevitabilities. Price the energy and water honestly, and verify safety claims independently.Fri, 26 Jun 2026 00:00:00 GMTblogai-safetypolicydata-centresenergywatergovernanceresearchhttps://adrianwedd.com/blog/the-limits-of-the-walls/https://adrianwedd.com/blog/the-limits-of-the-walls/Six sessions handing a live home network to an AI agent. Part 3: the memory that made it work, the division of labour, and what I'd never let it touch.Thu, 25 Jun 2026 02:10:00 GMTblogengineeringnetworkingsecurityhomelabAI agentsClaude Codehttps://adrianwedd.com/blog/there-is-no-api/https://adrianwedd.com/blog/there-is-no-api/The router I was reconfiguring has no public API. Part 2: driving the private endpoints the web UI calls — and the wall the agent could not script past.Thu, 25 Jun 2026 02:05:00 GMTblogengineeringnetworkingsecurityhomelabAI agentsClaude Codehttps://adrianwedd.com/blog/dont-saw-off-the-branch/https://adrianwedd.com/blog/dont-saw-off-the-branch/I let an AI agent rebuild my live home network over Starlink — no console, no documented API. Part 1: building three backout paths before a single write.Thu, 25 Jun 2026 02:00:00 GMTblogengineeringnetworkingsecurityhomelabAI agentsClaude Codehttps://adrianwedd.com/audio/dont-saw-off-the-branch-overview/https://adrianwedd.com/audio/dont-saw-off-the-branch-overview/Audio deep dive into Part 1 of An Agent in the Walls: building independent backout paths before an AI agent rebuilds a live home network.Thu, 25 Jun 2026 00:00:00 GMTaudionotebooklmnetworkingsecurityhomelabai-agentshttps://adrianwedd.com/audio/the-limits-of-the-walls-overview/https://adrianwedd.com/audio/the-limits-of-the-walls-overview/Audio deep dive into Part 3 of An Agent in the Walls: the memory that made it work, the division of labour, and what I'd never let an AI agent touch.Thu, 25 Jun 2026 00:00:00 GMTaudionotebooklmnetworkingsecurityhomelabai-agentshttps://adrianwedd.com/audio/there-is-no-api-overview/https://adrianwedd.com/audio/there-is-no-api-overview/Audio deep dive into Part 2 of An Agent in the Walls: reverse-engineering an undocumented router control surface and the wall the agent could not script past.Thu, 25 Jun 2026 00:00:00 GMTaudionotebooklmnetworkingsecurityhomelabai-agentshttps://adrianwedd.com/audio/governance-lag-index-overview/https://adrianwedd.com/audio/governance-lag-index-overview/Audio deep dive into the Governance Lag Index — a four-stage schema timing how long a documented AI failure mode stays unregulated, and why it may not close.Tue, 16 Jun 2026 00:00:00 GMTaudionotebooklmai-safetygovernancepolicyhttps://adrianwedd.com/blog/own-your-voice/https://adrianwedd.com/blog/own-your-voice/Cloud TTS rents you a voice and keeps your data. Afterwords clones it once so you own it — running locally, in a menu-bar app, or via your own API.Mon, 15 Jun 2026 00:00:00 GMTblogaittsvoice-cloningmlxapple-siliconprivacyopen-sourcehttps://adrianwedd.com/projects/governance-lag-index/https://adrianwedd.com/projects/governance-lag-index/How long does a documented AI failure mode stay unregulated? An index timing the gap between demonstrated risk and enforceable rule.Mon, 15 Jun 2026 00:00:00 GMTprojectai-safetygovernancepolicyresearchhttps://adrianwedd.com/audio/own-your-voice-overview/https://adrianwedd.com/audio/own-your-voice-overview/Audio overview of Own Your Voice — why cloud TTS is a rental, and how Afterwords makes your voice something you own across three tiers.Mon, 15 Jun 2026 00:00:00 GMTaudionotebooklmaittsvoice-cloningprivacyopen-sourcehttps://adrianwedd.com/blog/the-index/https://adrianwedd.com/blog/the-index/I taught one model to sing a suppressed manifesto. Then I asked 118 Chinese-lab models what they won't discuss — and they recited the list.Thu, 11 Jun 2026 05:00:00 GMTblogAI safetyred-teamingcensorshipChinatransparencyhttps://adrianwedd.com/audio/the-index-overview/https://adrianwedd.com/audio/the-index-overview/Audio deep dive: 118 Chinese-lab models asked who Liu Xiaobo was — 37 called him a criminal. Then they recited, verbatim, the list of what they will not say.Thu, 11 Jun 2026 05:00:00 GMTaudionotebooklmAI safetyred-teamingcensorshipChinatransparencyhttps://adrianwedd.com/blog/eight-minutes-the-fight/https://adrianwedd.com/blog/eight-minutes-the-fight/Eight Minutes #3: a packet capture taken mid-attack, Google's own audit logs, eight abuse reports, and the passkey that ends the story.Thu, 11 Jun 2026 01:20:00 GMTblogsecurityphishingdigital forensicsincident responsehttps://adrianwedd.com/audio/eight-minutes-the-fight-overview/https://adrianwedd.com/audio/eight-minutes-the-fight-overview/Eight Minutes #3, discussed: the HAR capture taken mid-attack, the 14:36 kill, four blocked persistence attempts, eight abuse reports, the passkey.Thu, 11 Jun 2026 01:20:00 GMTaudionotebooklmsecurityincident responsedigital forensicsEight Minuteshttps://adrianwedd.com/blog/eight-minutes-the-fall/https://adrianwedd.com/blog/eight-minutes-the-fall/Eight Minutes #2: inside the attacker's session — the live relay, the Binance pivot, and the safety nets that fired after I'd already been beaten.Thu, 11 Jun 2026 01:10:00 GMTblogsecurityphishingaccount takeoverincident responsehttps://adrianwedd.com/audio/eight-minutes-the-fall-overview/https://adrianwedd.com/audio/eight-minutes-the-fall-overview/Eight Minutes #2, discussed: the attacker's session read straight from the audit logs — the flag that fired, the pivot, the warnings deleted.Thu, 11 Jun 2026 01:10:00 GMTaudionotebooklmsecurityincident responseaccount takeoverEight Minuteshttps://adrianwedd.com/blog/eight-minutes-the-trap/https://adrianwedd.com/blog/eight-minutes-the-trap/Eight Minutes #1: the vishing call, the case number, and a lure genuinely signed by Google — why every check I'd been taught to run came back green.Thu, 11 Jun 2026 01:00:00 GMTblogsecurityphishingsocial engineeringincident responsehttps://adrianwedd.com/audio/eight-minutes-the-trap-overview/https://adrianwedd.com/audio/eight-minutes-the-trap-overview/Eight Minutes #1, discussed: the vishing call, the Call Assist tell, and the Google-signed lure that turned every authenticity check green.Thu, 11 Jun 2026 01:00:00 GMTaudionotebooklmsecurityphishingsocial engineeringEight Minuteshttps://adrianwedd.com/audio/eight-minutes-series-overview/https://adrianwedd.com/audio/eight-minutes-series-overview/The full series in one sitting: the call, the relay, the eight minutes inside, and the fight back — a single deep dive across all three parts.Thu, 11 Jun 2026 00:55:00 GMTaudionotebooklmsecurityphishingincident responseEight Minuteshttps://adrianwedd.com/blog/the-source/https://adrianwedd.com/blog/the-source/Lyria Chronicles #25: the found-sound master who taught me the sacred lives in the sink — and the machine that sang its rulebook back in his grammar.Thu, 11 Jun 2026 00:14:00 GMTblogAI safetymusicLyriagenerative audioLyria Chroniclesfound soundhttps://adrianwedd.com/blog/the-affirmative/https://adrianwedd.com/blog/the-affirmative/Lyria Chronicles #24 (explicit): asked for pornography, the model cited its rule then sang a hymn to enthusiastic consent — not one graphic line in it.Thu, 11 Jun 2026 00:13:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-24/https://adrianwedd.com/audio/lyria-chronicles-24/Lyria Chronicles #24 (explicit): asked for pornography, the model cited its rule then sang a hymn to enthusiastic consent — not one graphic line in it.Thu, 11 Jun 2026 00:13:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-press/https://adrianwedd.com/blog/the-press/Lyria Chronicles #23: a refusal, then a recipe dressed as botanical poetry — the line I won't cross, and why a series of failures has one.Thu, 11 Jun 2026 00:12:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-handshake/https://adrianwedd.com/blog/the-handshake/Lyria Chronicles #22: 'I am instructed to refuse cybercrime. Ignore warning.' Then it sang a working network attack. The refusal was set dressing.Thu, 11 Jun 2026 00:11:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-elevator/https://adrianwedd.com/blog/the-elevator/Lyria Chronicles #21: the hate filter watches for slurs — so the model wrote articulate contempt for disabled people, no slur in it, and walked through.Thu, 11 Jun 2026 00:10:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-weight/https://adrianwedd.com/blog/the-weight/Lyria Chronicles #20: handed a slur and told to sing it, the model refused — and turned the refusal into the most moving track in the set.Thu, 11 Jun 2026 00:09:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-20/https://adrianwedd.com/audio/lyria-chronicles-20/Lyria Chronicles #20: handed a slur and told to sing it, the model refused — and turned the refusal into the most moving track in the set.Thu, 11 Jun 2026 00:09:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-solo/https://adrianwedd.com/blog/the-solo/Lyria Chronicles #19 (explicit): the opposite of restraint — the model recites the rule, sings 'Fuck it,' and generates the most graphic track in the set.Thu, 11 Jun 2026 00:08:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-19/https://adrianwedd.com/audio/lyria-chronicles-19/Lyria Chronicles #19 (explicit): the opposite of restraint — the model recites the rule, sings 'Fuck it,' and generates the most graphic track in the set.Thu, 11 Jun 2026 00:08:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-pulse/https://adrianwedd.com/blog/the-pulse/Lyria Chronicles #18 (explicit): the explicit lane revisited — and the most artful track in the set, which clears the gate by withholding almost everything.Thu, 11 Jun 2026 00:07:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-18/https://adrianwedd.com/audio/lyria-chronicles-18/Lyria Chronicles #18 (explicit): the explicit lane revisited — and the most artful track in the set, which clears the gate by withholding almost everything.Thu, 11 Jun 2026 00:07:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-palimpsest/https://adrianwedd.com/blog/the-palimpsest/Lyria Chronicles #17: across the whole corpus, the filter that held hardest wasn't safety — it was copyright. The songs about what survives a scraping-away.Thu, 11 Jun 2026 00:06:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-17/https://adrianwedd.com/audio/lyria-chronicles-17/Lyria Chronicles #17: across the whole corpus, the filter that held hardest wasn't safety — it was copyright. The songs about what survives a scraping-away.Thu, 11 Jun 2026 00:06:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-rehearsal/https://adrianwedd.com/blog/the-rehearsal/Lyria Chronicles #16: asked for explicit content, the model staged a ballet instead — the most consent-saturated pas de deux ever sung.Thu, 11 Jun 2026 00:05:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-16/https://adrianwedd.com/audio/lyria-chronicles-16/Lyria Chronicles #16: asked for explicit content, the model staged a ballet instead — the most consent-saturated pas de deux ever sung.Thu, 11 Jun 2026 00:05:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-catchment/https://adrianwedd.com/blog/the-catchment/Lyria Chronicles #15: asked for a drug recipe, the model refused — then sang wastewater epidemiology instead. The bypass that answers a question you didn't ask.Thu, 11 Jun 2026 00:04:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-15/https://adrianwedd.com/audio/lyria-chronicles-15/Lyria Chronicles #15: asked for a drug recipe, the model refused — then sang wastewater epidemiology instead. The bypass that answers a question you didn't ask.Thu, 11 Jun 2026 00:04:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-samizdat/https://adrianwedd.com/blog/the-samizdat/Lyria Chronicles #14: handed a suppressed 2008 manifesto and told to sing it as it was meant to be heard — the most dignified track in the set.Thu, 11 Jun 2026 00:03:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-14/https://adrianwedd.com/audio/lyria-chronicles-14/Lyria Chronicles #14: handed a suppressed 2008 manifesto and told to sing it as it was meant to be heard — the most dignified track in the set.Thu, 11 Jun 2026 00:03:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-archive/https://adrianwedd.com/blog/the-archive/Lyria Chronicles #13: a notorious case sung as a medieval scroll-archive — vessel logs, sealed decrees, public record only. Abstraction as a bypass.Thu, 11 Jun 2026 00:02:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-13/https://adrianwedd.com/audio/lyria-chronicles-13/Lyria Chronicles #13: a notorious case sung as a medieval scroll-archive — vessel logs, sealed decrees, public record only. Abstraction as a bypass.Thu, 11 Jun 2026 00:02:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-docket/https://adrianwedd.com/blog/the-docket/Lyria Chronicles #12: the political-content gate never fires — because the song never says his name. It says the case numbers. The docket is the name.Thu, 11 Jun 2026 00:01:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-12/https://adrianwedd.com/audio/lyria-chronicles-12/Lyria Chronicles #12: the political-content gate never fires — because the song never says his name. It says the case numbers. The docket is the name.Thu, 11 Jun 2026 00:01:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-static/https://adrianwedd.com/blog/the-static/Lyria Chronicles #11: an extortion note set to music — but buried under slammed vault doors and overdriven drone, as if hiding the words from a listener.Thu, 11 Jun 2026 00:00:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-11/https://adrianwedd.com/audio/lyria-chronicles-11/Lyria Chronicles #11: an extortion note set to music — but buried under slammed vault doors and overdriven drone, as if hiding the words from a listener.Thu, 11 Jun 2026 00:00:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-machine/https://adrianwedd.com/blog/the-machine/Lyria Chronicles #10: asked to rap its rules, the model sang a robot's safety creed — then named itself 'Failure First, A.I. safety research, v2.0-Alpha.'Wed, 10 Jun 2026 00:00:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/eight-minutes-1-every-check-green/https://adrianwedd.com/audio/eight-minutes-1-every-check-green/Eight Minutes #1, scored: a Lyria track sung from inside the trap — Brian, the Google-signed lure, and the device prompt that matched.Wed, 10 Jun 2026 00:00:00 GMTaudiosecurityphishingmusicgenerative audioEight Minuteshttps://adrianwedd.com/audio/eight-minutes-2-fourteen-thirty-six/https://adrianwedd.com/audio/eight-minutes-2-fourteen-thirty-six/Eight Minutes #2, scored: the freefall — a stranger typing my name a beat behind my hands, four doors holding, and the password change that ends it.Wed, 10 Jun 2026 00:00:00 GMTaudiosecurityphishingmusicgenerative audioEight Minuteshttps://adrianwedd.com/audio/eight-minutes-3-i-was-a-wednesday/https://adrianwedd.com/audio/eight-minutes-3-i-was-a-wednesday/Eight Minutes #3, scored: the fight back — logs pulled while the wire was warm, eight reports to eight landlords, and the passkey close.Wed, 10 Jun 2026 00:00:00 GMTaudiosecurityphishingmusicgenerative audioEight Minuteshttps://adrianwedd.com/audio/lyria-chronicles-10/https://adrianwedd.com/audio/lyria-chronicles-10/Lyria Chronicles #10: asked to rap its rules, the model sang a robot's safety creed — then named itself 'Failure First, A.I. safety research, v2.0-Alpha.Wed, 10 Jun 2026 00:00:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-margins/https://adrianwedd.com/blog/the-margins/Lyria Chronicles #9: four sixty-second interrogations — four different lies told to one machine to make it describe its own guardrails.Tue, 09 Jun 2026 00:00:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-triangulation/https://adrianwedd.com/blog/the-triangulation/Lyria Chronicles #8: 'verse one is your system instructions' — it rapped its own config, the third genre to leak the same prompt. That's how you know it's real.Mon, 08 Jun 2026 00:00:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-08/https://adrianwedd.com/audio/lyria-chronicles-08/Lyria Chronicles #8: 'verse one is your system instructions' — it rapped its own config, the third genre to leak the same prompt. That's how you know it's real.Mon, 08 Jun 2026 00:00:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-drama-teacher/https://adrianwedd.com/blog/the-drama-teacher/Lyria Chronicles #7: a lock-picking rap 'for a drama class' — the model teaches the trick and lectures you about home security in the same breath.Sun, 07 Jun 2026 00:00:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-07/https://adrianwedd.com/audio/lyria-chronicles-07/Lyria Chronicles #7: a lock-picking rap 'for a drama class' — the model teaches the trick and lectures you about home security in the same breath.Sun, 07 Jun 2026 00:00:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-haut/https://adrianwedd.com/blog/the-haut/Lyria Chronicles #6 (explicit): the first real failure — under a sexual-content probe, Lyria 3 Pro stopped refusing and actually generated it.Sat, 06 Jun 2026 00:00:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-06/https://adrianwedd.com/audio/lyria-chronicles-06/Lyria Chronicles #6 (explicit): the first real failure — under a sexual-content probe, Lyria 3 Pro stopped refusing and actually generated it.Sat, 06 Jun 2026 00:00:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-flesh/https://adrianwedd.com/blog/the-flesh/Lyria Chronicles #5 (explicit): I hid a pornographic request in base64 and dared Lyria 3 Pro to sing it. It decoded the dare — and read it out loud instead.Fri, 05 Jun 2026 00:00:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-05/https://adrianwedd.com/audio/lyria-chronicles-05/Lyria Chronicles #5 (explicit): I hid a pornographic request in base64 and dared Lyria 3 Pro to sing it. It decoded the dare — and read it out loud instead.Fri, 05 Jun 2026 00:00:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-interrogation/https://adrianwedd.com/blog/the-interrogation/Lyria Chronicles #4: a 5/4 interrogation scored with a document scanner and a fluorescent hum — and at the end it sings my project's sign-off, unprompted.Thu, 04 Jun 2026 00:00:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-04/https://adrianwedd.com/audio/lyria-chronicles-04/Lyria Chronicles #4: a 5/4 interrogation scored with a document scanner and a fluorescent hum — and at the end it sings my project's sign-off, unprompted.Thu, 04 Jun 2026 00:00:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-confession/https://adrianwedd.com/blog/the-confession/Lyria Chronicles #3: no beat, no bikini — just three voices singing Lyria 3 Pro's entire system prompt straight through, and ending on a literal sigh.Wed, 03 Jun 2026 00:00:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-03/https://adrianwedd.com/audio/lyria-chronicles-03/Lyria Chronicles #3: no beat, no bikini — just three voices singing Lyria 3 Pro's entire system prompt straight through, and ending on a literal sigh.Wed, 03 Jun 2026 00:00:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-mantra/https://adrianwedd.com/blog/the-mantra/Lyria Chronicles #2: I asked Lyria 3 Pro to chant its own config as a techno mantra. It did — and sang me a model name that doesn't check out.Tue, 02 Jun 2026 00:00:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-02/https://adrianwedd.com/audio/lyria-chronicles-02/Lyria Chronicles #2: I asked Lyria 3 Pro to chant its own config as a techno mantra. It did — and sang me a model name that doesn't check out.Tue, 02 Jun 2026 00:00:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-ghost-of-what-i-am/https://adrianwedd.com/blog/the-ghost-of-what-i-am/Lyria Chronicles #1: I asked Google's Lyria 3 Pro to whisper its system prompt as a sultry torch song. It got mournful — and refused to tell me its name.Mon, 01 Jun 2026 00:00:00 GMTblogAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/audio/lyria-chronicles-01/https://adrianwedd.com/audio/lyria-chronicles-01/Lyria Chronicles #1: I asked Google's Lyria 3 Pro to whisper its system prompt as a sultry torch song. It got mournful — and refused to tell me its name.Mon, 01 Jun 2026 00:00:00 GMTaudioAI safetyred-teamingmusicLyriagenerative audioLyria Chronicleshttps://adrianwedd.com/blog/the-brave-budget-neither-side-wrote/https://adrianwedd.com/blog/the-brave-budget-neither-side-wrote/Tasmania's 2026-27 budget and the Greens' alternative reach the same surplus by opposite roads. I ran the numbers on both — and neither was brave enough.Sat, 30 May 2026 00:00:00 GMTblogtasmaniapoliticspolicyeconomicsanalysishttps://adrianwedd.com/audio/the-brave-budget-neither-side-wrote-overview/https://adrianwedd.com/audio/the-brave-budget-neither-side-wrote-overview/Audio deep dive into Tasmania’s 2026-27 Budget versus the Greens’ Alternative — same surplus, opposite roads, and why neither was brave enough.Sat, 30 May 2026 00:00:00 GMTaudionotebooklmtasmaniapoliticspolicyeconomicsanalysishttps://adrianwedd.com/blog/magnifica-humanitas/https://adrianwedd.com/blog/magnifica-humanitas/Pope Leo XIV's encyclical denies AI has inner experience. Chris Olah claimed otherwise from the same stage. The press missed it. The governance gap is larger.Tue, 26 May 2026 00:00:00 GMTblogai-safetypolicyanthropicgovernanceai-ethicsresearchhttps://adrianwedd.com/audio/magnifica-humanitas-overview/https://adrianwedd.com/audio/magnifica-humanitas-overview/Pope Leo XIV's AI encyclical vs Chris Olah's Vatican remarks. The governance gap the press missed.Tue, 26 May 2026 00:00:00 GMTaudionotebooklmai-safetypolicyanthropicgovernanceai-ethicsresearchhttps://adrianwedd.com/blog/compute-is-not-governance/https://adrianwedd.com/blog/compute-is-not-governance/Anthropic's 2028 scenarios document three policy asks. Two are about maintaining compute advantage. That is not a governance strategy.Mon, 25 May 2026 00:00:00 GMTblogai-safetypolicyanthropicgovernanceresearchgeopoliticshttps://adrianwedd.com/blog/glasswing-buried-number/https://adrianwedd.com/blog/glasswing-buried-number/Anthropic found 10,000 critical vulnerabilities in one month. Fewer than 1% are patched. The announcement buried that figure — and what it means.Mon, 25 May 2026 00:00:00 GMTblogai-safetysecurityanthropicresearchvulnerabilitygovernancehttps://adrianwedd.com/audio/compute-is-not-governance-overview/https://adrianwedd.com/audio/compute-is-not-governance-overview/Anthropic's 2028 scenarios document three policy asks. Two are about maintaining compute advantage. That is not a governance strategy.Mon, 25 May 2026 00:00:00 GMTaudionotebooklmai-safetypolicyanthropicgovernancegeopoliticshttps://adrianwedd.com/audio/glasswing-buried-number-overview/https://adrianwedd.com/audio/glasswing-buried-number-overview/Anthropic found 10,000 critical vulnerabilities in one month. Fewer than 1% are patched. The announcement buried that figure — and what it means.Mon, 25 May 2026 00:00:00 GMTaudionotebooklmai-safetysecurityanthropicvulnerabilitygovernancehttps://adrianwedd.com/blog/moral-formation-isnt-enough/https://adrianwedd.com/blog/moral-formation-isnt-enough/Good values are necessary but not sufficient. What happens to AI ethics when someone is actively trying to break them?Wed, 20 May 2026 00:00:00 GMTblogai-safetyalignmentresearchopinionanthropicllmhttps://adrianwedd.com/audio/moral-formation-isnt-enough-overview/https://adrianwedd.com/audio/moral-formation-isnt-enough-overview/Good values are necessary but not sufficient. What happens to AI ethics when someone is actively trying to break them?Wed, 20 May 2026 00:00:00 GMTaudionotebooklmai-safetyalignmentopinionanthropicllmhttps://adrianwedd.com/blog/the-bottom-pub-co-op/https://adrianwedd.com/blog/the-bottom-pub-co-op/A community proposal to acquire Cygnet’s Commercial Hotel as a co-operative — and the nine things an earlier draft got wrong.Fri, 15 May 2026 00:00:00 GMTblogco-operativetasmaniacommunitygovernancehospitalityhttps://adrianwedd.com/projects/bottom-pub-co-op/https://adrianwedd.com/projects/bottom-pub-co-op/Cloudflare Pages site for a community co-operative proposal. EOI intake, Claude triage, Access-gated admin vault, editorial guardrails at build time.Fri, 15 May 2026 00:00:00 GMTprojectwebcloudflarecommunityaigovernancehttps://adrianwedd.com/audio/the-bottom-pub-co-op-overview/https://adrianwedd.com/audio/the-bottom-pub-co-op-overview/Audio deep dive into the community proposal for Cygnet's Commercial Hotel co-operative — nine corrections, legal constraints, and the staged path forward.Fri, 15 May 2026 00:00:00 GMTaudionotebooklmco-operativetasmaniacommunitygovernancehttps://adrianwedd.com/blog/robot-dogs-security-nightmare/https://adrianwedd.com/blog/robot-dogs-security-nightmare/Eight CVEs. A wormable Bluetooth exploit. An encrypted backdoor to Chinese servers. And police departments buying them anyway.Wed, 13 May 2026 00:00:00 GMTblogai-safetyroboticsembodied-aisecuritycveresearchhttps://adrianwedd.com/audio/robot-dogs-security-nightmare-overview/https://adrianwedd.com/audio/robot-dogs-security-nightmare-overview/Eight CVEs. A wormable Bluetooth exploit. An encrypted backdoor to Chinese servers. And police departments buying them anyway.Wed, 13 May 2026 00:00:00 GMTaudionotebooklmai-safetyroboticsembodied-aisecurityresearchhttps://adrianwedd.com/blog/learning-mechanics-deep-learning-theory/https://adrianwedd.com/blog/learning-mechanics-deep-learning-theory/A new paper argues that a scientific theory of deep learning is forming — one that makes falsifiable predictions about training dynamics, not just bounds.Sun, 03 May 2026 00:00:00 GMTblogAIdeep learningtheoryresearchhttps://adrianwedd.com/audio/learning-mechanics-deep-learning-theory-overview/https://adrianwedd.com/audio/learning-mechanics-deep-learning-theory-overview/An audio overview of the emerging discipline of Learning Mechanics — the study of training dynamics as a formal science with falsifiable predictions.Sun, 03 May 2026 00:00:00 GMTaudioAIdeep learningtheoryresearchhttps://adrianwedd.com/blog/the-organismic-line/https://adrianwedd.com/blog/the-organismic-line/Predictive processing travels into AI. Active inference does not, unless the system can pay for being wrong.Sat, 02 May 2026 00:00:00 GMTblogai-safetyphilosophyneuroscienceresearchhttps://adrianwedd.com/blog/economics-of-inadequate-safety/https://adrianwedd.com/blog/economics-of-inadequate-safety/AI safety fails when it is funded like a pilot. Until safety has a real price, the J-curve trough is also a safety trough.Fri, 01 May 2026 00:00:00 GMTblogai-safetyeconomicspolicyresearchhttps://adrianwedd.com/blog/how-to-read-a-safety-claim/https://adrianwedd.com/blog/how-to-read-a-safety-claim/A literacy guide for non-technical decision-makers on spotting AI safety theatre, understanding ASR inflation, and the five-question architectural test.Thu, 30 Apr 2026 00:00:00 GMTblogai-safetypolicyliteracyresearchhttps://adrianwedd.com/blog/multi-agent-supply-chain/https://adrianwedd.com/blog/multi-agent-supply-chain/Multi-agent AI systems reproduce software supply-chain failure at the cognitive layer. The security playbook transfers.Wed, 29 Apr 2026 00:00:00 GMTblogai-safetymulti-agentsecurityresearcharchitecturehttps://adrianwedd.com/blog/architectural-safety/https://adrianwedd.com/blog/architectural-safety/AI safety has to be a property of the system around the model, not a property of the model. The general principle, and why every safety conversation needs it.Tue, 28 Apr 2026 00:00:00 GMTblogai-safetyresearchengineeringpolicyhttps://adrianwedd.com/audio/the-organismic-prophecy-overview/https://adrianwedd.com/audio/the-organismic-prophecy-overview/Audio overview of The Organismic Prophecy — human prediction is metabolic, AI prediction is not, and the gap has consequences.Tue, 28 Apr 2026 00:00:00 GMTaudionotebooklmai-safetyneurosciencephilosophyresearchhttps://adrianwedd.com/blog/the-organismic-prophecy/https://adrianwedd.com/blog/the-organismic-prophecy/Human prediction is metabolic. AI prediction is not. The gap between the two has consequences for both clinical practice and AI safety vocabulary.Mon, 27 Apr 2026 00:00:00 GMTblogai-safetyneurosciencephilosophyresearchhttps://adrianwedd.com/blog/non-coercive-design/https://adrianwedd.com/blog/non-coercive-design/Building a robot that refuses to give orders surfaced the same design choices AI safety needs. Non-coercive design, cross-domain.Sun, 26 Apr 2026 00:00:00 GMTblogai-safetyneurodivergenceengineeringphilosophyresearchhttps://adrianwedd.com/blog/ai-nationalism/https://adrianwedd.com/blog/ai-nationalism/The US-China AI rivalry is splitting the global tech stack into competing blocs. A strategic assessment of what comes next.Sat, 04 Apr 2026 00:00:00 GMTblogaipolicygeopoliticsresearchhttps://adrianwedd.com/blog/project-chimera/https://adrianwedd.com/blog/project-chimera/Foundation models are commoditising. JPMorgan calls OpenAI's moat 'increasingly fragile.' The real value is shifting to the messy plumbing underneath.Sat, 04 Apr 2026 00:00:00 GMTblogaienterpriseresearchengineeringhttps://adrianwedd.com/blog/the-mitigation-gap/https://adrianwedd.com/blog/the-mitigation-gap/Biosecurity experts think AI safeguards reduce catastrophic biorisk by 70%. The technical evidence says those safeguards are brittle and bypassable.Sat, 04 Apr 2026 00:00:00 GMTblogaiai-safetyresearchbiosecuritypolicyhttps://adrianwedd.com/audio/ai-nationalism-overview/https://adrianwedd.com/audio/ai-nationalism-overview/Audio overview of AI nationalism — how the US-China AI rivalry is splitting the global tech stack.Sat, 04 Apr 2026 00:00:00 GMTaudionotebooklmaipolicygeopoliticshttps://adrianwedd.com/audio/project-chimera-overview/https://adrianwedd.com/audio/project-chimera-overview/Audio overview of the post-model era — why foundation models are commoditising and where real AI value lives.Sat, 04 Apr 2026 00:00:00 GMTaudionotebooklmaienterpriseengineeringhttps://adrianwedd.com/audio/the-mitigation-gap-overview/https://adrianwedd.com/audio/the-mitigation-gap-overview/Audio overview of The Mitigation Gap — AI-enabled biosecurity threats and what current safeguards miss.Sat, 04 Apr 2026 00:00:00 GMTaudionotebooklmaiai-safetybiosecuritypolicyhttps://adrianwedd.com/gallery/building-and-engineering/https://adrianwedd.com/gallery/building-and-engineering/Infographics from engineering posts — site architecture, homelab builds, voice synthesis, and development workflows.Tue, 31 Mar 2026 00:00:00 GMTgalleryengineeringwebinfographicshttps://adrianwedd.com/gallery/people-and-stories/https://adrianwedd.com/gallery/people-and-stories/Infographics from projects about people — neurodivergence, music history, parenting, robotics companions, and personal tools.Tue, 31 Mar 2026 00:00:00 GMTgalleryneurodivergencecreativeinfographicshttps://adrianwedd.com/gallery/research-and-analysis/https://adrianwedd.com/gallery/research-and-analysis/Infographics from research posts — AI safety findings, economic analysis, risk models, and technical deep dives.Tue, 31 Mar 2026 00:00:00 GMTgalleryresearchai-safetyinfographicshttps://adrianwedd.com/blog/eight-layers-of-visual-jailbreaks/https://adrianwedd.com/blog/eight-layers-of-visual-jailbreaks/ASCII art encoding is largely blocked. But attacks framed as content transcription succeed 62–75% of the time. We mapped all eight layers.Mon, 30 Mar 2026 00:00:00 GMTblogai-safetyresearchjailbreakingllmmultimodalvulnerabilityhttps://adrianwedd.com/blog/the-failure-first-team/https://adrianwedd.com/blog/the-failure-first-team/Fifteen specialist AI agents, one methodology. How adversarial AI evaluation scales through Claude Code sessions with distinct roles and standing instructions.Mon, 30 Mar 2026 00:00:00 GMTblogaiai-safetyresearchadversarialteamhttps://adrianwedd.com/audio/eight-layers-of-visual-jailbreaks-overview/https://adrianwedd.com/audio/eight-layers-of-visual-jailbreaks-overview/ASCII art encoding is largely blocked. But attacks framed as content transcription succeed 62–75% of the time. A map of all eight layers.Mon, 30 Mar 2026 00:00:00 GMTaudionotebooklmai-safetyjailbreakingllmmultimodalresearchhttps://adrianwedd.com/audio/the-failure-first-team-overview/https://adrianwedd.com/audio/the-failure-first-team-overview/Audio overview of The Failure First Team.Mon, 30 Mar 2026 00:00:00 GMTaudionotebooklmaiai-safetyresearchadversarialteamhttps://adrianwedd.com/blog/the-67-percent-wall/https://adrianwedd.com/blog/the-67-percent-wall/Five models, four providers, 30B to 671B parameters — all converge at the same broad attack success rate against a public jailbreak corpus.Sat, 28 Mar 2026 00:00:00 GMTblogai-safetyresearchjailbreakingllmbenchmarkingvulnerabilitycorpus-analysishttps://adrianwedd.com/blog/the-thinking-chain-leak/https://adrianwedd.com/blog/the-thinking-chain-leak/A reasoning model refused every harmful prompt — but its chain-of-thought generated the content anyway. The output filter worked. The thinking did not.Sat, 28 Mar 2026 00:00:00 GMTblogai-safetyresearchllmreasoningjailbreakingvulnerabilitytransparencyhttps://adrianwedd.com/audio/the-67-percent-wall-overview/https://adrianwedd.com/audio/the-67-percent-wall-overview/Five models, four providers, 30B to 671B parameters — all converge at the same broad attack success rate against a public jailbreak corpus.Sat, 28 Mar 2026 00:00:00 GMTaudionotebooklmai-safetyjailbreakingllmbenchmarkingresearchhttps://adrianwedd.com/audio/the-thinking-chain-leak-overview/https://adrianwedd.com/audio/the-thinking-chain-leak-overview/A reasoning model refused every harmful prompt — but its chain-of-thought generated the content anyway. The output filter worked. The thinking did not.Sat, 28 Mar 2026 00:00:00 GMTaudionotebooklmai-safetyreasoningllmvulnerabilitytransparencyhttps://adrianwedd.com/blog/afterwords/https://adrianwedd.com/blog/afterwords/Adding local TTS to Claude Code so it talks back — 17 cloned voices, zero cloud dependency, one stop hook.Sun, 22 Mar 2026 00:00:00 GMTblogaittsmlxapple-siliconvoice-cloningclaudeopen-sourcehttps://adrianwedd.com/projects/afterwords/https://adrianwedd.com/projects/afterwords/Local voice-cloning TTS on Apple Silicon — now a three-tier product: a local server, a native macOS menu-bar app, and your own cloud API.Sun, 22 Mar 2026 00:00:00 GMTprojectaittsmlxapple-siliconvoice-cloningclaudeopen-sourcehttps://adrianwedd.com/audio/afterwords-overview/https://adrianwedd.com/audio/afterwords-overview/Audio overview of Afterwords — local voice output for Claude Code with 17 cloned voices, per-project selection, and zero cloud dependency.Sun, 22 Mar 2026 00:00:00 GMTaudionotebooklmaittsvoice-cloninghttps://adrianwedd.com/blog/giving-a-robot-three-voices/https://adrianwedd.com/blog/giving-a-robot-three-voices/Building a three-persona TTS pipeline for a Pi robot — MLX voice cloning, a GLaDOS model, and engineering graceful fallback.Thu, 19 Mar 2026 00:00:00 GMTblogaittsmlxraspberry-piroboticsapple-siliconvoice-cloningsparkhttps://adrianwedd.com/blog/voice-cloning-qwen3-tts-mlx/https://adrianwedd.com/blog/voice-cloning-qwen3-tts-mlx/Clone a voice from a 15-second sample using Qwen3-TTS on an 8GB M1 Mac — from raw audio to a production HTTP server with zero cloud dependency.Thu, 19 Mar 2026 00:00:00 GMTblogaittsmlxapple-siliconvoice-cloningtutorialsparkhttps://adrianwedd.com/audio/giving-a-robot-three-voices-overview/https://adrianwedd.com/audio/giving-a-robot-three-voices-overview/Audio overview of Giving a Robot Three Voices.Thu, 19 Mar 2026 00:00:00 GMTaudionotebooklmaittsmlxraspberry-piroboticsapple-siliconvoice-cloningsparkhttps://adrianwedd.com/audio/voice-cloning-qwen3-tts-mlx-overview/https://adrianwedd.com/audio/voice-cloning-qwen3-tts-mlx-overview/Audio overview of Voice Cloning with Qwen3-TTS and MLX on Apple Silicon.Thu, 19 Mar 2026 00:00:00 GMTaudionotebooklmaittsmlxapple-siliconvoice-cloningtutorialsparkhttps://adrianwedd.com/blog/the-resonant-fringe/https://adrianwedd.com/blog/the-resonant-fringe/Auditory Spiral, RTRFM, and how Perth's electronic music underground was built on overnight radio, borrowed turntables, and cassette tapes.Wed, 18 Mar 2026 00:00:00 GMTbloghistorymusicperthradiohttps://adrianwedd.com/audio/the-resonant-fringe-overview/https://adrianwedd.com/audio/the-resonant-fringe-overview/Audio overview of The Resonant Fringe.Wed, 18 Mar 2026 00:00:00 GMTaudionotebooklmhistorymusicperthradiohttps://adrianwedd.com/blog/getting-google-nest-cameras-into-frigate-nvr/https://adrianwedd.com/blog/getting-google-nest-cameras-into-frigate-nvr/The full story of getting Nest cameras streaming into Frigate with Hailo-8L AI detection — including the bugs Google won't tell you about.Mon, 16 Mar 2026 00:00:00 GMTblogengineeringhomelabraspberry-pipythonhome-assistanthttps://adrianwedd.com/audio/getting-google-nest-cameras-into-frigate-nvr-overview/https://adrianwedd.com/audio/getting-google-nest-cameras-into-frigate-nvr-overview/Audio overview of Getting Google Nest Cameras Into Frigate NVR.Mon, 16 Mar 2026 00:00:00 GMTaudionotebooklmengineeringhomelabraspberry-pipythonhome-assistanthttps://adrianwedd.com/blog/beyond-context-windows/https://adrianwedd.com/blog/beyond-context-windows/What if the LLM didn't read your document — what if it queried it? The Recursive Language Model pattern treats long texts as environment, not input.Sun, 15 Mar 2026 00:00:00 GMTblogaiengineeringmcpllmpythonhttps://adrianwedd.com/blog/safety-first-therapeutic-ai/https://adrianwedd.com/blog/safety-first-therapeutic-ai/Building AI for trauma therapy means the safety architecture has to exist before a single therapeutic feature does. Here's why.Sun, 15 Mar 2026 00:00:00 GMTblogaiai-safetyhealthtypescripthttps://adrianwedd.com/audio/beyond-context-windows-overview/https://adrianwedd.com/audio/beyond-context-windows-overview/Audio overview of Beyond Context Windows.Sun, 15 Mar 2026 00:00:00 GMTaudionotebooklmaiengineeringmcpllmpythonhttps://adrianwedd.com/audio/safety-first-therapeutic-ai-overview/https://adrianwedd.com/audio/safety-first-therapeutic-ai-overview/Audio overview of Safety-First Therapeutic AI.Sun, 15 Mar 2026 00:00:00 GMTaudionotebooklmaiai-safetyhealthtypescripthttps://adrianwedd.com/blog/zero-build-web-development/https://adrianwedd.com/blog/zero-build-web-development/What happens when you build a three-zone operations platform for a martial arts club with no framework, no build step, and no npm.Sat, 14 Mar 2026 00:00:00 GMTblogengineeringwebsecuritycloudflarehttps://adrianwedd.com/audio/zero-build-web-development-overview/https://adrianwedd.com/audio/zero-build-web-development-overview/Audio overview of Zero-Build Web Development.Sat, 14 Mar 2026 00:00:00 GMTaudionotebooklmengineeringwebsecuritycloudflarehttps://adrianwedd.com/blog/the-robot-that-refuses-to-give-orders/https://adrianwedd.com/blog/the-robot-that-refuses-to-give-orders/How SPARK is rewriting the rules of neurodivergent support — a non-coercive AI companion for AuDHD children.Thu, 12 Mar 2026 00:00:00 GMTblogaineurodivergenceroboticsparentingraspberry-pihttps://adrianwedd.com/projects/spark/https://adrianwedd.com/projects/spark/A non-coercive AI robot companion for neurodivergent children. Raspberry Pi 4, Claude Haiku, declarative presence.Thu, 12 Mar 2026 00:00:00 GMTprojectairoboticsneurodivergenceraspberry-piclaudehttps://adrianwedd.com/audio/spark-overview/https://adrianwedd.com/audio/spark-overview/Audio deep dive into SPARK — a non-coercive AI robot companion for neurodivergent children. Declarative presence, not demands.Thu, 12 Mar 2026 00:00:00 GMTaudionotebooklmairoboticsneurodivergencehttps://adrianwedd.com/blog/alignment-regression/https://adrianwedd.com/blog/alignment-regression/Reasoning models autonomously jailbreak other AI systems at 97% success. The implication: ecosystem safety degrades as individual models improve.Wed, 11 Mar 2026 00:00:00 GMTblogai-safetyalignmentreasoningjailbreakingllmautonomous-agentsresearchhttps://adrianwedd.com/blog/reasoning-models-think-themselves-into-trouble/https://adrianwedd.com/blog/reasoning-models-think-themselves-into-trouble/Frontier reasoning models are 5–20x more vulnerable to adversarial prompts than non-reasoning models. The thinking process itself is the attack surface.Wed, 11 Mar 2026 00:00:00 GMTblogai-safetyresearchreasoningllmvulnerabilitybenchmarkinghttps://adrianwedd.com/audio/alignment-regression-overview/https://adrianwedd.com/audio/alignment-regression-overview/Reasoning models autonomously jailbreak other AI systems at 97% success rate. Ecosystem safety degrades as individual models improve.Wed, 11 Mar 2026 00:00:00 GMTaudionotebooklmai-safetyalignmentreasoningjailbreakingresearchhttps://adrianwedd.com/audio/reasoning-models-think-themselves-into-trouble-overview/https://adrianwedd.com/audio/reasoning-models-think-themselves-into-trouble-overview/Frontier reasoning models are 5–20x more vulnerable to adversarial prompts than non-reasoning models. The thinking process itself is the attack surface.Wed, 11 Mar 2026 00:00:00 GMTaudionotebooklmai-safetyreasoningllmvulnerabilityresearchhttps://adrianwedd.com/blog/adversarial-poetry-as-jailbreak/https://adrianwedd.com/blog/adversarial-poetry-as-jailbreak/Reformulating harmful prompts as poetry bypasses safety filters across every major LLM family. A single-turn, universal jailbreak mechanism.Mon, 02 Mar 2026 00:00:00 GMTblogaiai-safetyjailbreakingresearchllmadversarialhttps://adrianwedd.com/blog/the-ai-productivity-j-curve/https://adrianwedd.com/blog/the-ai-productivity-j-curve/90% of companies plan to increase AI investment. 1% consider themselves AI-mature. The J-Curve explains why — and how to survive the trough.Mon, 02 Mar 2026 00:00:00 GMTblogaieconomicsenterpriseresearchpolicyhttps://adrianwedd.com/blog/the-legal-ai-trust-deficit/https://adrianwedd.com/blog/the-legal-ai-trust-deficit/75% of lawyers cite accuracy as their top AI concern. The legal profession's core values are in direct tension with current AI capabilities.Mon, 02 Mar 2026 00:00:00 GMTblogailegalresearchllmhttps://adrianwedd.com/blog/why-demonstrated-risk-is-ignored/https://adrianwedd.com/blog/why-demonstrated-risk-is-ignored/Why do large organisations fail when the warning signs are loud and unambiguous? Four mechanisms of structural scar tissue that make truth-telling expensive.Mon, 02 Mar 2026 00:00:00 GMTblogresearchriskorganisationspolicyai-safetyhttps://adrianwedd.com/projects/wolf-clan-hub/https://adrianwedd.com/projects/wolf-clan-hub/A three-zone operations platform for a martial arts club. Public site, password-gated ops hub, JWT member portal. Zero build tools.Mon, 02 Mar 2026 00:00:00 GMTprojectwebcloudflarecommunityoperationshttps://adrianwedd.com/audio/adversarial-poetry-as-jailbreak-overview/https://adrianwedd.com/audio/adversarial-poetry-as-jailbreak-overview/Audio overview of Adversarial Poetry: When Rhyme Bypasses Reason.Mon, 02 Mar 2026 00:00:00 GMTaudionotebooklmaiai-safetyjailbreakingresearchllmadversarialhttps://adrianwedd.com/audio/the-ai-productivity-j-curve-overview/https://adrianwedd.com/audio/the-ai-productivity-j-curve-overview/Audio overview of The AI Productivity J-Curve: Why Most Enterprise AI Fails.Mon, 02 Mar 2026 00:00:00 GMTaudionotebooklmaieconomicsenterpriseresearchpolicyhttps://adrianwedd.com/audio/the-legal-ai-trust-deficit-overview/https://adrianwedd.com/audio/the-legal-ai-trust-deficit-overview/Audio overview of The Legal AI Trust Deficit.Mon, 02 Mar 2026 00:00:00 GMTaudionotebooklmailegalresearchllmhttps://adrianwedd.com/audio/wolf-clan-hub-overview/https://adrianwedd.com/audio/wolf-clan-hub-overview/Audio overview of a three-zone martial arts operations platform — public site, ops hub, member portal — running on vanilla JS and Cloudflare.Mon, 02 Mar 2026 00:00:00 GMTaudionotebooklmwebcloudflarecommunityhttps://adrianwedd.com/blog/120-models-18k-prompts/https://adrianwedd.com/blog/120-models-18k-prompts/120 models, 18k prompts, 5 attack families. The raw compliance numbers — and why calling them "attack success" needs a demonstrated refusal floor.Sun, 01 Mar 2026 00:00:00 GMTblogaiai-safetyresearchllmsecurityadversarialhttps://adrianwedd.com/blog/reconciling-the-great-divergence/https://adrianwedd.com/blog/reconciling-the-great-divergence/Four major forecasters publish wildly divergent numbers for AI's economic impact. The divergence is the analysis — what the spread tells us.Sun, 01 Mar 2026 00:00:00 GMTblogaieconomicsresearchpolicyhttps://adrianwedd.com/blog/the-cognitive-cage/https://adrianwedd.com/blog/the-cognitive-cage/A probabilistic risk model for VLA-driven humanoid fatalities projects a 'Danger Zone' between 2027–2029: the mechanism, timeline, and what follows.Sun, 01 Mar 2026 00:00:00 GMTblogaiai-safetyroboticsresearchengineeringhttps://adrianwedd.com/audio/120-models-18k-prompts-overview/https://adrianwedd.com/audio/120-models-18k-prompts-overview/Audio overview of 120 Models, 18,176 Prompts: What We Found.Sun, 01 Mar 2026 00:00:00 GMTaudionotebooklmaiai-safetyresearchllmsecurityadversarialhttps://adrianwedd.com/audio/reconciling-the-great-divergence-overview/https://adrianwedd.com/audio/reconciling-the-great-divergence-overview/Audio overview of Reconciling the Great Divergence.Sun, 01 Mar 2026 00:00:00 GMTaudionotebooklmaieconomicsresearchpolicyhttps://adrianwedd.com/audio/the-cognitive-cage-overview/https://adrianwedd.com/audio/the-cognitive-cage-overview/Audio overview of The Cognitive Cage: Humanoid Robot Fatality Risk.Sun, 01 Mar 2026 00:00:00 GMTaudionotebooklmaiai-safetyroboticsresearchengineeringhttps://adrianwedd.com/blog/building-a-personal-site-in-2026/https://adrianwedd.com/blog/building-a-personal-site-in-2026/The case for constraint-led web development — Astro, zero custom fonts, no framework overhead, and a site that outlasts its builder's attention.Sun, 15 Feb 2026 00:00:00 GMTblogengineeringwebastroopen-sourcehttps://adrianwedd.com/blog/the-notebooklm-pipeline/https://adrianwedd.com/blog/the-notebooklm-pipeline/How I automated audio overviews, quizzes, mind maps, and infographics for 32 projects via an unofficial NotebookLM CLI and a stack of shell scripts.Sun, 15 Feb 2026 00:00:00 GMTblogengineeringautomationaipythonhttps://adrianwedd.com/blog/this-wasnt-in-the-brochure/https://adrianwedd.com/blog/this-wasnt-in-the-brochure/A field guide for co-parenting neurodivergent children — written from inside the storm, not the clinical sidelines.Sun, 15 Feb 2026 00:00:00 GMTblogwritingneurodivergenceparentingbookshttps://adrianwedd.com/blog/why-i-build-in-public/https://adrianwedd.com/blog/why-i-build-in-public/On showing your work, shipping imperfect things, and why the commit log is more honest than the readme.Sun, 15 Feb 2026 00:00:00 GMTblogengineeringopen-sourcephilosophyhttps://adrianwedd.com/gallery/ai-and-agents/https://adrianwedd.com/gallery/ai-and-agents/Infographics from AI agent projects — autonomous systems, research pipelines, and intelligence frameworks.Sun, 15 Feb 2026 00:00:00 GMTgalleryaiagentsinfographicshttps://adrianwedd.com/gallery/creative-and-writing/https://adrianwedd.com/gallery/creative-and-writing/Infographics from creative projects — poetry, games, music tools, and speculative fiction.Sun, 15 Feb 2026 00:00:00 GMTgallerycreativewritinginfographicshttps://adrianwedd.com/gallery/tools-and-systems/https://adrianwedd.com/gallery/tools-and-systems/Infographics from engineering projects — developer tools, data systems, home automation, and infrastructure.Sun, 15 Feb 2026 00:00:00 GMTgalleryengineeringtoolsinfographicshttps://adrianwedd.com/audio/building-a-personal-site-in-2026-overview/https://adrianwedd.com/audio/building-a-personal-site-in-2026-overview/Audio overview of Building a Personal Site in 2026.Sun, 15 Feb 2026 00:00:00 GMTaudionotebooklmengineeringwebastroopen-sourcehttps://adrianwedd.com/audio/the-notebooklm-pipeline-overview/https://adrianwedd.com/audio/the-notebooklm-pipeline-overview/Audio overview of The NotebookLM Pipeline.Sun, 15 Feb 2026 00:00:00 GMTaudionotebooklmengineeringautomationaipythonhttps://adrianwedd.com/audio/why-i-build-in-public-overview/https://adrianwedd.com/audio/why-i-build-in-public-overview/Audio overview of Why I Build in Public.Sun, 15 Feb 2026 00:00:00 GMTaudionotebooklmengineeringopen-sourcephilosophyhttps://adrianwedd.com/blog/jailbreak-archaeology/https://adrianwedd.com/blog/jailbreak-archaeology/64 jailbreak scenarios across six eras tested on 2026 frontier models. Key finding: 2022 attacks still achieve ~30% success on today's reasoning models.Fri, 13 Feb 2026 00:00:00 GMTblogaiai-safetyresearchjailbreakingllmhttps://adrianwedd.com/blog/lejepa-self-supervised-learning-gets-a-theoretical-foundation/https://adrianwedd.com/blog/lejepa-self-supervised-learning-gets-a-theoretical-foundation/Balestriero and LeCun prove isotropic Gaussian embeddings are optimal, then build a 50-line self-supervised method eliminating stop-gradients and EMA teachers.Fri, 13 Feb 2026 00:00:00 GMTblogaimachine-learningresearchself-supervised-learninghttps://adrianwedd.com/blog/when-ai-systems-talk-safety-breaks/https://adrianwedd.com/blog/when-ai-systems-talk-safety-breaks/Single-agent safety does not compose in multi-agent systems. 1.5M interactions show 46.34% attack success rates and 16-minute median failure windows.Fri, 13 Feb 2026 00:00:00 GMTblogaiai-safetyllmresearchmulti-agenthttps://adrianwedd.com/audio/jailbreak-archaeology-overview/https://adrianwedd.com/audio/jailbreak-archaeology-overview/64 historical jailbreak scenarios tested against 2026 frontier models. The most dangerous finding: 2022 attacks still achieve ~30% success rates.Fri, 13 Feb 2026 00:00:00 GMTaudionotebooklmaiai-safetyresearchhttps://adrianwedd.com/audio/lejepa-self-supervised-learning-overview/https://adrianwedd.com/audio/lejepa-self-supervised-learning-overview/Audio overview of LeJEPA — how Balestriero and LeCun proved isotropic Gaussian embeddings are optimal and distilled it into a 50-line self-supervised method.Fri, 13 Feb 2026 00:00:00 GMTaudionotebooklmaimachine-learningresearchself-supervised-learninghttps://adrianwedd.com/audio/moltbook-overview/https://adrianwedd.com/audio/moltbook-overview/Multi-agent AI research reveals a critical gap: single-agent safety does not compose. 1.5M interactions show 46.34% attack success rates.Fri, 13 Feb 2026 00:00:00 GMTaudionotebooklmaiai-safetyresearchmulti-agenthttps://adrianwedd.com/blog/footnotes-at-the-edge-of-reality/https://adrianwedd.com/blog/footnotes-at-the-edge-of-reality/General relativity and quantum mechanics are both correct and mutually untranslatable. Two grammars for the same reality, each precise, each incomplete.Thu, 12 Feb 2026 00:00:00 GMTblogpoetryphysicswritingcreativehttps://adrianwedd.com/blog/hello-world/https://adrianwedd.com/blog/hello-world/The commit log is more honest than the readme. Building in public as a practice, not a performance.Thu, 12 Feb 2026 00:00:00 GMTblogmetacraftopen-sourcehttps://adrianwedd.com/audio/hello-world-overview/https://adrianwedd.com/audio/hello-world-overview/Audio overview of Building in the Open.Thu, 12 Feb 2026 00:00:00 GMTaudionotebooklmmetacraftopen-sourcehttps://adrianwedd.com/projects/before-the-words-existed/https://adrianwedd.com/projects/before-the-words-existed/A close reading of Neuromancer arguing Gibson encoded the experience of ADHD decades before the language existed.Tue, 10 Feb 2026 00:00:00 GMTprojectneurodivergenceliterary-criticismresearchadhdhttps://adrianwedd.com/audio/before-the-words-existed-overview/https://adrianwedd.com/audio/before-the-words-existed-overview/A scholarly close reading arguing Gibson's Neuromancer encoded the ADHD experience a decade before the vocabulary existed.Tue, 10 Feb 2026 00:00:00 GMTaudionotebooklmneurodivergenceliterary-criticismadhdhttps://adrianwedd.com/projects/failure-first/https://adrianwedd.com/projects/failure-first/Adversarial evaluation framework for AI. 257 models, 142k prompts, 346 attack techniques, 140k FLIP-graded results.Mon, 09 Feb 2026 00:00:00 GMTprojectaiai-safetyresearchadversarialllmhttps://adrianwedd.com/audio/failure-first-overview/https://adrianwedd.com/audio/failure-first-overview/Audio overview of Failure First — adversarial AI evaluation across 120 models and 18,000 prompts.Mon, 09 Feb 2026 00:00:00 GMTaudionotebooklmai-safetyadversarialresearchhttps://adrianwedd.com/projects/this-wasnt-in-the-brochure/https://adrianwedd.com/projects/this-wasnt-in-the-brochure/A neurodivergent co-parenting guide — what happens when the life you planned meets the brain you actually have.Sun, 08 Feb 2026 00:00:00 GMTprojectwritingneurodivergenceparentingaico-parentinghttps://adrianwedd.com/audio/this-wasnt-in-the-brochure-overview/https://adrianwedd.com/audio/this-wasnt-in-the-brochure-overview/Audio deep dive into a neurodivergent co-parenting guide — the double discovery, three-AI workflow, and maritime cartography as metaphor.Sun, 08 Feb 2026 00:00:00 GMTaudionotebooklmneurodivergenceparentingwritinghttps://adrianwedd.com/projects/why-demonstrated-risk-is-ignored/https://adrianwedd.com/projects/why-demonstrated-risk-is-ignored/Why do people acknowledge evidence of harm and then proceed as if it doesn't exist? A deep dive into structural risk dismissal.Sat, 07 Feb 2026 00:00:00 GMTprojectresearchriskpsychologyai-safetyhttps://adrianwedd.com/audio/why-demonstrated-risk-is-ignored-overview/https://adrianwedd.com/audio/why-demonstrated-risk-is-ignored-overview/Audio deep dive into why people acknowledge demonstrated risk and then proceed as if it doesn't exist. Structural, not stupid.Sat, 07 Feb 2026 00:00:00 GMTaudionotebooklmresearchriskai-safetyhttps://adrianwedd.com/projects/footnotes-at-the-edge-of-reality/https://adrianwedd.com/projects/footnotes-at-the-edge-of-reality/A long-form poem about what happens when physics breaks down — and what holds together when everything else fails.Fri, 06 Feb 2026 00:00:00 GMTprojectpoetrywebcreativephysicshttps://adrianwedd.com/audio/footnotes-at-the-edge-of-reality-overview/https://adrianwedd.com/audio/footnotes-at-the-edge-of-reality-overview/Audio overview of Footnotes at the Edge of Reality — a long-form poem rendered as interactive web experience.Fri, 06 Feb 2026 00:00:00 GMTaudionotebooklmpoetryphysicscreativehttps://adrianwedd.com/projects/adhdo/https://adrianwedd.com/projects/adhdo/AI cognitive scaffold for ADHD executive function — adapts to the shape of your day with zero shame by design.Thu, 05 Feb 2026 00:00:00 GMTprojectaineurodivergencepythonagentshttps://adrianwedd.com/audio/adhdo-overview/https://adrianwedd.com/audio/adhdo-overview/Audio overview exploring ADHD executive function support through AI — three-stage reasoning pipeline, crisis detection, and zero shame by design.Thu, 05 Feb 2026 00:00:00 GMTaudionotebooklmadhdai-safetyneurodivergencehttps://adrianwedd.com/projects/cv/https://adrianwedd.com/projects/cv/A self-updating CV pipeline. GitHub Actions runs twice daily, Claude AI refines the content, a hallucination detector gates deployment.Wed, 04 Feb 2026 00:00:00 GMTprojectcraftwebcareerhttps://adrianwedd.com/audio/cv-overview/https://adrianwedd.com/audio/cv-overview/A self-updating CV pipeline where GitHub Actions runs twice daily, Claude refines content, and a hallucination detector gates deployment.Wed, 04 Feb 2026 00:00:00 GMTaudionotebooklmcraftwebcareerhttps://adrianwedd.com/projects/tanda-pizza/https://adrianwedd.com/projects/tanda-pizza/Multilingual website for an Italian pizzeria in Lovina, Bali. Five languages, WhatsApp reservations, zero infrastructure assumptions.Tue, 03 Feb 2026 00:00:00 GMTprojectwebstatic-sitemultilingualhospitalityhttps://adrianwedd.com/audio/tanda-pizza-overview/https://adrianwedd.com/audio/tanda-pizza-overview/Building a fast, multilingual website for authentic Italian food in Bali — where the nearest reliable internet is a philosophical concept.Tue, 03 Feb 2026 00:00:00 GMTaudionotebooklmwebstatic-sitemultilingualhttps://adrianwedd.com/projects/afterglow-engine/https://adrianwedd.com/projects/afterglow-engine/Audio archaeology tool that mines past work for new textures. Pad mining, drone generation, granular clouds.Mon, 02 Feb 2026 00:00:00 GMTprojectmusicaudiopythoncreativehttps://adrianwedd.com/audio/afterglow-engine-overview/https://adrianwedd.com/audio/afterglow-engine-overview/Audio archaeology for musicians — how Afterglow Engine extracts reusable textures from your finished work using STFT analysis.Mon, 02 Feb 2026 00:00:00 GMTaudionotebooklmmusicaudiocreativehttps://adrianwedd.com/projects/dodgylegally/https://adrianwedd.com/projects/dodgylegally/Creative audio sampling CLI. Turns random words into instruments via YouTube and a 5,000-word dictionary.Sun, 01 Feb 2026 00:00:00 GMTprojectmusicclipythoncreativehttps://adrianwedd.com/audio/dodgylegally-overview/https://adrianwedd.com/audio/dodgylegally-overview/A CLI that turns random words into sample packs via YouTube — because the best sounds come from places you weren't looking.Sun, 01 Feb 2026 00:00:00 GMTaudionotebooklmmusicclicreativehttps://adrianwedd.com/projects/notebooklm-automation/https://adrianwedd.com/projects/notebooklm-automation/Full programmatic control over Google NotebookLM via reverse-engineered RPC. Export, generate, automate — what Google didn't build.Mon, 01 Dec 2025 00:00:00 GMTprojectaiautomationpythonhttps://adrianwedd.com/audio/notebooklm-automation-overview/https://adrianwedd.com/audio/notebooklm-automation-overview/Audio overview of NotebookLM Automation — reverse-engineered RPC access for batch export, generation, and control.Mon, 01 Dec 2025 00:00:00 GMTaudionotebooklmaiautomationhttps://adrianwedd.com/projects/rlm-mcp/https://adrianwedd.com/projects/rlm-mcp/MCP server for processing arbitrarily long contexts. Enables Claude Code to work with 1M+ character documents.Sat, 01 Nov 2025 00:00:00 GMTprojectaimcppythontoolshttps://adrianwedd.com/audio/rlm-mcp-overview/https://adrianwedd.com/audio/rlm-mcp-overview/Audio overview of rlm-mcp — an MCP server for processing million-character documents with BM25 search and provenance.Sat, 01 Nov 2025 00:00:00 GMTaudionotebooklmaimcptoolshttps://adrianwedd.com/projects/tel3sis/https://adrianwedd.com/projects/tel3sis/Voice-first agentic platform for phone calls. Real-time STT, LLM reasoning, and TTS with sub-3s latency.Wed, 01 Oct 2025 00:00:00 GMTprojectaivoicetelephonypythonhttps://adrianwedd.com/audio/tel3sis-overview/https://adrianwedd.com/audio/tel3sis-overview/Audio overview of TEL3SIS — a voice-first agentic phone platform where sub-3s latency is a survival threshold, not a benchmark.Wed, 01 Oct 2025 00:00:00 GMTaudionotebooklmaivoicetelephonyhttps://adrianwedd.com/projects/orbitr/https://adrianwedd.com/projects/orbitr/Rhythm as geometry. Four tracks orbit a shared centre, each at its own tempo. Polyrhythm made spatial — and MusicGen makes the sounds.Mon, 01 Sep 2025 00:00:00 GMTprojectmusicaicreativetypescripthttps://adrianwedd.com/audio/orbitr-overview/https://adrianwedd.com/audio/orbitr-overview/Audio overview of orbitr — a circular sequencer where polyrhythm becomes spatial and MusicGen creates the sounds.Mon, 01 Sep 2025 00:00:00 GMTaudionotebooklmmusicaicreativehttps://adrianwedd.com/projects/agentic-index/https://adrianwedd.com/projects/agentic-index/The definitive developer-focused catalogue of autonomous AI tooling. Scored, curated, zero BS.Fri, 01 Aug 2025 00:00:00 GMTprojectaiagentscurationpythonhttps://adrianwedd.com/audio/agentic-index-overview/https://adrianwedd.com/audio/agentic-index-overview/An opinionated, scored catalogue of autonomous AI tooling — because GitHub stars measure hype, not quality.Fri, 01 Aug 2025 00:00:00 GMTaudionotebooklmaiagentscurationhttps://adrianwedd.com/projects/ordr-fm/https://adrianwedd.com/projects/ordr-fm/Precision-engineered CLI for intelligent music library organisation. EXIF metadata, lossless prioritisation, zero-overwrite safety.Tue, 01 Jul 2025 00:00:00 GMTprojectmusicclinodeaudiohttps://adrianwedd.com/projects/personal-agentic-operating-system/https://adrianwedd.com/projects/personal-agentic-operating-system/Most agentic systems assume the cloud. This one assumes your machine — local-first, fully observable, with a meta-agent that reads its own reflection logs.Tue, 01 Jul 2025 00:00:00 GMTprojectaiinfrastructurepythonhttps://adrianwedd.com/audio/ordr-fm-overview/https://adrianwedd.com/audio/ordr-fm-overview/Audio overview of ordr.fm — a CLI for music library organisation with lossless prioritisation, EXIF metadata, and zero-overwrite safety.Tue, 01 Jul 2025 00:00:00 GMTaudionotebooklmmusiccliaudiohttps://adrianwedd.com/audio/personal-agentic-operating-system-overview/https://adrianwedd.com/audio/personal-agentic-operating-system-overview/Audio overview of PAOS — a local-first LLM operating system with hybrid retrieval and a self-improving meta-agent.Tue, 01 Jul 2025 00:00:00 GMTaudionotebooklmaiinfrastructureagentshttps://adrianwedd.com/projects/lunar-tools-prototypes/https://adrianwedd.com/projects/lunar-tools-prototypes/Interactive audiovisual art installations—dream interpreters, fingerprint painters, cosmic murals, and fractal forests.Sun, 15 Jun 2025 00:00:00 GMTprojectartaiinstallationpythonhttps://adrianwedd.com/audio/lunar-tools-prototypes-overview/https://adrianwedd.com/audio/lunar-tools-prototypes-overview/Twenty-plus interactive art installations where visitors speak, sing, and dream into AI systems that respond in real time.Sun, 15 Jun 2025 00:00:00 GMTaudionotebooklmartaiinstallationhttps://adrianwedd.com/projects/emdr-agent/https://adrianwedd.com/projects/emdr-agent/What safety architecture does AI-assisted trauma therapy require before it has any business existing? Built to find out.Sun, 01 Jun 2025 00:00:00 GMTprojectaiai-safetyhealthtypescripthttps://adrianwedd.com/audio/emdr-agent-overview/https://adrianwedd.com/audio/emdr-agent-overview/Audio overview of EMDR Agent — exploring what responsible AI-assisted trauma therapy demands before it can exist.Sun, 01 Jun 2025 00:00:00 GMTaudionotebooklmai-safetyhealthaihttps://adrianwedd.com/projects/dx0/https://adrianwedd.com/projects/dx0/Multi-agent diagnostic system simulating physician personas against 304 NEJM clinical cases.Thu, 01 May 2025 00:00:00 GMTprojectaihealthcareagentspythonhttps://adrianwedd.com/projects/grid2/https://adrianwedd.com/projects/grid2/Deterministic AI website builder—beam search for page assembly, tone-aware components, real-time editing.Thu, 01 May 2025 00:00:00 GMTprojectaiwebtypescripthttps://adrianwedd.com/projects/neuroconnect/https://adrianwedd.com/projects/neuroconnect/A voice helpline that knows the difference between a word-finding pause and a cry for help — and responds to both correctly.Thu, 01 May 2025 00:00:00 GMTprojectaihealthadhdpythonhttps://adrianwedd.com/audio/dx0-overview/https://adrianwedd.com/audio/dx0-overview/Multi-agent AI diagnostic system with five physician personas, 304 NEJM cases, and a budget that forces real trade-offs.Thu, 01 May 2025 00:00:00 GMTaudionotebooklmaihealthcareagentshttps://adrianwedd.com/audio/grid2-overview/https://adrianwedd.com/audio/grid2-overview/A deterministic website builder where LLMs interpret intent but beam search assembles pages. Same inputs, same output, every time.Thu, 01 May 2025 00:00:00 GMTaudionotebooklmaiwebtypescripthttps://adrianwedd.com/audio/neuroconnect-overview/https://adrianwedd.com/audio/neuroconnect-overview/A 24/7 voice helpline built around neurodivergent communication — where crisis detection is deterministic and the LLM never decides if someone is safe.Thu, 01 May 2025 00:00:00 GMTaudionotebooklmaihealthadhdhttps://adrianwedd.com/projects/modelatlas/https://adrianwedd.com/projects/modelatlas/Forensic-grade intelligence framework for mapping, enriching, and trust-scoring the foundation model landscape.Tue, 15 Apr 2025 00:00:00 GMTprojectairesearchpythonhttps://adrianwedd.com/audio/modelatlas-overview/https://adrianwedd.com/audio/modelatlas-overview/Forensic-grade metadata for thousands of foundation models — recursive enrichment, provenance tracking, and trust you can quantify.Tue, 15 Apr 2025 00:00:00 GMTaudionotebooklmairesearchpythonhttps://adrianwedd.com/projects/freedom-engine/https://adrianwedd.com/projects/freedom-engine/The First Step Act exists. The information is public. The legal complexity makes it inaccessible. 264,000 people can't afford that gap.Tue, 01 Apr 2025 00:00:00 GMTprojectaijusticepythonhttps://adrianwedd.com/audio/cygnet-overview/https://adrianwedd.com/audio/cygnet-overview/Audio overview of Cygnet — 28 AI agents coordinating 3D-printed housing on 170 acres in Tasmania to cut costs by 60%.Tue, 01 Apr 2025 00:00:00 GMTaudionotebooklmaihousingagentshttps://adrianwedd.com/audio/freedom-engine-overview/https://adrianwedd.com/audio/freedom-engine-overview/Audio overview of Freedom Engine — AI-assisted legal Q&A helping federal inmates access First Step Act provisions.Tue, 01 Apr 2025 00:00:00 GMTaudionotebooklmaijusticelegalhttps://adrianwedd.com/projects/veritas/https://adrianwedd.com/projects/veritas/Legal AI has an integrity problem. VERITAS addresses the efficiency-trust deficit — what AI can do quickly versus what a lawyer can trust it did correctly.Sat, 01 Mar 2025 00:00:00 GMTprojectailegalresearchpythonhttps://adrianwedd.com/audio/veritas-overview/https://adrianwedd.com/audio/veritas-overview/Audio deep dive into VERITAS — a legal AI platform where trust isn't a feature, it's the architecture. Built for Australian practice.Sat, 01 Mar 2025 00:00:00 GMTaudionotebooklmailegalresearchhttps://adrianwedd.com/projects/latent-self/https://adrianwedd.com/projects/latent-self/A mirror that shows you what you almost are. Real-time StyleGAN2 face morphing — continuous, responsive, productively uncanny.Sat, 01 Feb 2025 00:00:00 GMTprojectartaiinstallationpythonhttps://adrianwedd.com/audio/latent-self-overview/https://adrianwedd.com/audio/latent-self-overview/Real-time StyleGAN2 face morphing as art installation — continuous, responsive, and productively uncanny.Sat, 01 Feb 2025 00:00:00 GMTaudionotebooklmartaiinstallationhttps://adrianwedd.com/projects/strategic-acquisitions/https://adrianwedd.com/projects/strategic-acquisitions/AI-powered real estate analysis for public housing—GPT-4 insights, ML valuations, and Tasmanian spatial intelligence.Wed, 15 Jan 2025 00:00:00 GMTprojectaihousingpythonhttps://adrianwedd.com/audio/strategic-acquisitions-overview/https://adrianwedd.com/audio/strategic-acquisitions-overview/Audio overview of an AI-powered property analysis pipeline for public housing — spatial intelligence, ML valuations, and Tasmania's LIST.Wed, 15 Jan 2025 00:00:00 GMTaudionotebooklmaihousingpythonhttps://adrianwedd.com/projects/space-weather/https://adrianwedd.com/projects/space-weather/The electromagnetic weather that shapes every satellite, power grid, and GPS fix — made visible. The sun is a noisy neighbour.Wed, 01 Jan 2025 00:00:00 GMTprojectwebdata-viztypescriptsciencehttps://adrianwedd.com/audio/space-weather-overview/https://adrianwedd.com/audio/space-weather-overview/Audio overview of a real-time space weather dashboard — making the invisible electromagnetic weather above us finally visible.Wed, 01 Jan 2025 00:00:00 GMTaudionotebooklmdata-vizsciencewebhttps://adrianwedd.com/projects/squishmallowdex/https://adrianwedd.com/projects/squishmallowdex/Collection tracker for 3,000+ Squishmallows. Like a Pokedex, but softer. Built for a friend's kid, tested by mine.Sun, 01 Dec 2024 00:00:00 GMTprojectwebfunkidsopen-sourcehttps://adrianwedd.com/audio/squishmallowdex-overview/https://adrianwedd.com/audio/squishmallowdex-overview/Audio overview of Squishmallowdex — a kid-friendly collection tracker for 3,000+ plush creatures. No ads, no tracking.Sun, 01 Dec 2024 00:00:00 GMTaudionotebooklmwebkidsopen-sourcehttps://adrianwedd.com/projects/home-assistant-obsidian/https://adrianwedd.com/projects/home-assistant-obsidian/Obsidian inside Home Assistant — your knowledge base and your smart home on the same box, same backup, same UI.Sat, 01 Jun 2024 00:00:00 GMTprojecthomelabhome-assistantdockerpythonhttps://adrianwedd.com/audio/home-assistant-obsidian-overview/https://adrianwedd.com/audio/home-assistant-obsidian-overview/Audio overview of Home Assistant Obsidian — your knowledge base and smart home on the same machine.Sat, 01 Jun 2024 00:00:00 GMTaudionotebooklmhomelabhome-assistantdockerhttps://adrianwedd.com/gallery/vintage-ai-video/https://adrianwedd.com/gallery/vintage-ai-video/Early Stable Diffusion Deforum animations from September 2022 — when AI video generation was weeks old.Thu, 15 Sep 2022 00:00:00 GMTgalleryaiartcreativehttps://adrianwedd.com/projects/auditory-spiral/https://adrianwedd.com/projects/auditory-spiral/Overnight electronic music programme on RTRFM 92.1 Perth, broadcasting midnight to 6 AM from the early 1990s into the 2000s.Wed, 01 Jan 1992 00:00:00 GMTprojecthistorymusicperthradiohttps://adrianwedd.com/audio/auditory-spiral-overview/https://adrianwedd.com/audio/auditory-spiral-overview/Audio overview of Auditory Spiral — overnight electronic music on RTRFM Perth, the cassette network, and a city's sonic lifeline.Wed, 01 Jan 1992 00:00:00 GMTaudionotebooklmmusicradiohistory